Brand: | Abnova |
Reference: | H00006185-A01 |
Product name: | RPN2 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant RPN2. |
Gene id: | 6185 |
Gene name: | RPN2 |
Gene alias: | RIBIIR|RPN-II|RPNII|SWP1 |
Gene description: | ribophorin II |
Genbank accession: | NM_002951 |
Immunogen: | RPN2 (NP_002942, 141 a.a. ~ 239 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | SQEALSALTARLSKEETVLATVQALQTASHLSQQADLRSIVEEIEDLVARLDELGGVYLQFEEGLETTALFVAATYKLMDHVGTEPSIKEDQVIQLMNA |
Protein accession: | NP_002942 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | RPN2 polyclonal antibody (A01), Lot # 051220JC01 Western Blot analysis of RPN2 expression in A-431 ( Cat # L015V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |