MRPS12 MaxPab mouse polyclonal antibody (B01) View larger

MRPS12 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MRPS12 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about MRPS12 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00006183-B01
Product name: MRPS12 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human MRPS12 protein.
Gene id: 6183
Gene name: MRPS12
Gene alias: MPR-S12|MT-RPS12|RPMS12|RPS12|RPSM12
Gene description: mitochondrial ribosomal protein S12
Genbank accession: NM_021107
Immunogen: MRPS12 (NP_066930, 1 a.a. ~ 138 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSWSGLLHGLNTSLTCGPALVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRKPKKPNSANRKCCRVRLSTGREAVCFIPGEGHTLQEHQIVLVEGGRTQDLPGVKLTVVRGKYDCGHVQKK
Protein accession: NP_066930
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006183-B01-13-15-1.jpg
Application image note: Western Blot analysis of MRPS12 expression in transfected 293T cell line (H00006183-T01) by MRPS12 MaxPab polyclonal antibody.

Lane 1: MRPS12 transfected lysate(15.18 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MRPS12 MaxPab mouse polyclonal antibody (B01) now

Add to cart