Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RPL15 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about RPL15 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00006138-A01 |
| Product name: | RPL15 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant RPL15. |
| Gene id: | 6138 |
| Gene name: | RPL15 |
| Gene alias: | EC45|FLJ26304|MGC88603|RPL10|RPLY10|RPYL10 |
| Gene description: | ribosomal protein L15 |
| Genbank accession: | NM_002948 |
| Immunogen: | RPL15 (NP_002939, 105 a.a. ~ 203 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | RAGRHCGALRVLNSYWVGEDSTYKFFEVILIDPFHKAIRRNPDTQWITKPVHKHREMRGLTSAGRKSRGLGKGHKFHHTIGGSRRAAWRRRNTLQLHRY |
| Protein accession: | NP_002939 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | A Novel Interaction Between Interferon-Inducible Protein p56 and Ribosomal Protein L15 in Gastric Cancer Cells.Hsu YA, Lin HJ, Sheu JJ, Shieh FK, Chen SY, Lai CH, Tsai FJ, Wan L, Chen BH. DNA Cell Biol. 2011 May 25. [Epub ahead of print] |