Brand: | Abnova |
Reference: | H00006132-A01 |
Product name: | RPL8 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant RPL8. |
Gene id: | 6132 |
Gene name: | RPL8 |
Gene alias: | - |
Gene description: | ribosomal protein L8 |
Genbank accession: | NM_000973 |
Immunogen: | RPL8 (NP_000964, 148 a.a. ~ 257 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | VKLPSGSKKVISSANRAVVGVVAGGGRIDKPILKAGRAYHKYKAKRNCWPRVRGVAMNPVEHPFGGGNHQHIGKPSTIRRDAPAGRKVGLIAARRTGRLRGTKTVQEKEN |
Protein accession: | NP_000964 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | RPL8 polyclonal antibody (A01), Lot # 051220JC01 Western Blot analysis of RPL8 expression in HepG2 ( Cat # L019V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |