Brand: | Abnova |
Reference: | H00006124-A01 |
Product name: | RPL4 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant RPL4. |
Gene id: | 6124 |
Gene name: | RPL4 |
Gene alias: | - |
Gene description: | ribosomal protein L4 |
Genbank accession: | NM_000968 |
Immunogen: | RPL4 (NP_000959, 251 a.a. ~ 350 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | IWTESAFRKLDELYGTWRKAASLKSNYNLPMHKMINTDLSRILKSPEIQRALRAPRKKIHRRVLKKNPLKNLRIMLKLNPYAKTMRRNTILRQARNHKLR |
Protein accession: | NP_000959 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |