RPE purified MaxPab mouse polyclonal antibody (B02P) View larger

RPE purified MaxPab mouse polyclonal antibody (B02P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RPE purified MaxPab mouse polyclonal antibody (B02P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,WB-Ti,WB-Tr

More info about RPE purified MaxPab mouse polyclonal antibody (B02P)

Brand: Abnova
Reference: H00006120-B02P
Product name: RPE purified MaxPab mouse polyclonal antibody (B02P)
Product description: Mouse polyclonal antibody raised against a full-length human RPE protein.
Gene id: 6120
Gene name: RPE
Gene alias: MGC2636|RPE2-1
Gene description: ribulose-5-phosphate-3-epimerase
Genbank accession: NM_199229.1
Immunogen: RPE (NP_954699.1, 1 a.a. ~ 228 a.a) full-length human protein.
Immunogen sequence/protein sequence: MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTSVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGPDTVHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKRSLDR
Protein accession: NP_954699.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006120-B02P-13-15-1.jpg
Application image note: Western Blot analysis of RPE expression in transfected 293T cell line (H00006120-T02) by RPE MaxPab polyclonal antibody.

Lane 1: RPE transfected lysate(25.08 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RPE purified MaxPab mouse polyclonal antibody (B02P) now

Add to cart