RPE MaxPab mouse polyclonal antibody (B01) View larger

RPE MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RPE MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,IF,WB-Tr

More info about RPE MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00006120-B01
Product name: RPE MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human RPE protein.
Gene id: 6120
Gene name: RPE
Gene alias: MGC2636|RPE2-1
Gene description: ribulose-5-phosphate-3-epimerase
Genbank accession: BC016764
Immunogen: RPE (AAH16764, 1 a.a. ~ 228 a.a) full-length human protein.
Immunogen sequence/protein sequence: MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTSVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGPDTVHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKRSLDR
Protein accession: AAH16764
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006120-B01-13-15-1.jpg
Application image note: Western Blot analysis of RPE expression in transfected 293T cell line (H00006120-T01) by RPE MaxPab polyclonal antibody.

Lane 1: RPE transfected lysate(25.19 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RPE MaxPab mouse polyclonal antibody (B01) now

Add to cart