Brand: | Abnova |
Reference: | H00006097-M01 |
Product name: | RORC monoclonal antibody (M01), clone 1G7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RORC. |
Clone: | 1G7 |
Isotype: | IgG2b Kappa |
Gene id: | 6097 |
Gene name: | RORC |
Gene alias: | MGC129539|NR1F3|RORG|RZR-GAMMA|RZRG|TOR |
Gene description: | RAR-related orphan receptor C |
Genbank accession: | NM_005060 |
Immunogen: | RORC (NP_005051.2, 412 a.a. ~ 517 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | FSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELFSTETESPVGLS |
Protein accession: | NP_005051.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.4 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | RORC monoclonal antibody (M01), clone 1G7. Western Blot analysis of RORC expression in human kidney. |
Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |