Brand: | Abnova |
Reference: | H00006051-M02 |
Product name: | RNPEP monoclonal antibody (M02), clone 4E1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RNPEP. |
Clone: | 4E1 |
Isotype: | IgG2b Kappa |
Gene id: | 6051 |
Gene name: | RNPEP |
Gene alias: | DKFZp547H084 |
Gene description: | arginyl aminopeptidase (aminopeptidase B) |
Genbank accession: | NM_020216 |
Immunogen: | RNPEP (NP_064601, 551 a.a. ~ 650 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GNVKKLGDTYPSISNARNAELRLRWGQIVLKNDHQEDFWKVKEFLHNQGKQKYTLPLYHAMMGGSEVAQTLAKETFASTASQLHSNVVNYVQQIVAPKGS |
Protein accession: | NP_064601 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged RNPEP is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,IP |
Shipping condition: | Dry Ice |