RNPEP polyclonal antibody (A01) View larger

RNPEP polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RNPEP polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about RNPEP polyclonal antibody (A01)

Brand: Abnova
Reference: H00006051-A01
Product name: RNPEP polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant RNPEP.
Gene id: 6051
Gene name: RNPEP
Gene alias: DKFZp547H084
Gene description: arginyl aminopeptidase (aminopeptidase B)
Genbank accession: NM_020216
Immunogen: RNPEP (NP_064601, 551 a.a. ~ 650 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: GNVKKLGDTYPSISNARNAELRLRWGQIVLKNDHQEDFWKVKEFLHNQGKQKYTLPLYHAMMGGSEVAQTLAKETFASTASQLHSNVVNYVQQIVAPKGS
Protein accession: NP_064601
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006051-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006051-A01-1-17-1.jpg
Application image note: RNPEP polyclonal antibody (A01), Lot # 061101JCS1 Western Blot analysis of RNPEP expression in C32 ( Cat # L002V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RNPEP polyclonal antibody (A01) now

Add to cart