Brand: | Abnova |
Reference: | H00006045-M13 |
Product name: | RNF2 monoclonal antibody (M13), clone 2F7 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant RNF2. |
Clone: | 2F7 |
Isotype: | IgG2a Kappa |
Gene id: | 6045 |
Gene name: | RNF2 |
Gene alias: | BAP-1|BAP1|DING|HIPI3|RING1B|RING2 |
Gene description: | ring finger protein 2 |
Genbank accession: | NM_007212 |
Immunogen: | RNF2 (NP_009143, 164 a.a. ~ 223 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | IENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAMAIDPVMDG |
Protein accession: | NP_009143 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (32.34 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | http://www.abnova.com/application_image/ |
Application image note: | Detection limit for recombinant GST tagged RNF2 is approximately 30ng/ml as a capture antibody. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |