Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RNF2 monoclonal antibody (M01), clone 6C2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
More info about RNF2 monoclonal antibody (M01), clone 6C2
| Brand: | Abnova |
| Reference: | H00006045-M01 |
| Product name: | RNF2 monoclonal antibody (M01), clone 6C2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RNF2. |
| Clone: | 6C2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6045 |
| Gene name: | RNF2 |
| Gene alias: | BAP-1|BAP1|DING|HIPI3|RING1B|RING2 |
| Gene description: | ring finger protein 2 |
| Genbank accession: | NM_007212 |
| Immunogen: | RNF2 (NP_009143, 192 a.a. ~ 290 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQ |
| Protein accession: | NP_009143 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | RNF2 monoclonal antibody (M01), clone 6C2 Western Blot analysis of RNF2 expression in NIH/3T3 ( Cat # L018V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |
| Publications: | Polycomb-group complex 1 acts as an E3 ubiquitin ligase for Geminin to sustain hematopoietic stem cell activity.Ohtsubo M, Yasunaga S, Ohno Y, Tsumura M, Okada S, Ishikawa N, Shirao K, Kikuchi A, Nishitani H, Kobayashi M, Takihara Y. Proc Natl Acad Sci U S A. 2008 Jul 29;105(30):10396-401. Epub 2008 Jul 23. |