RING1 monoclonal antibody (M01), clone 3G6 View larger

RING1 monoclonal antibody (M01), clone 3G6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RING1 monoclonal antibody (M01), clone 3G6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about RING1 monoclonal antibody (M01), clone 3G6

Brand: Abnova
Reference: H00006015-M01
Product name: RING1 monoclonal antibody (M01), clone 3G6
Product description: Mouse monoclonal antibody raised against a partial recombinant RING1.
Clone: 3G6
Isotype: IgG2b Kappa
Gene id: 6015
Gene name: RING1
Gene alias: RING1A|RNF1
Gene description: ring finger protein 1
Genbank accession: NM_002931
Immunogen: RING1 (NP_002922, 81 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NKECPTCRKKLVSKRSLRPDPNFDALISKIYPSREEYEAHQDRVLIRLSRLHNQQALSSSIEEGLRMQAMHRAQRVRRPIPGSDQTTTMS
Protein accession: NP_002922
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006015-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.64 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006015-M01-13-15-1.jpg
Application image note: Western Blot analysis of RING1 expression in transfected 293T cell line by RING1 monoclonal antibody (M01), clone 3G6.

Lane 1: RING1 transfected lysate(42.4 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RING1 monoclonal antibody (M01), clone 3G6 now

Add to cart