Brand: | Abnova |
Reference: | H00006011-M02 |
Product name: | GRK1 monoclonal antibody (M02), clone 4E9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GRK1. |
Clone: | 4E9 |
Isotype: | IgG2b Kappa |
Gene id: | 6011 |
Gene name: | GRK1 |
Gene alias: | GPRK1|RHOK|RK |
Gene description: | G protein-coupled receptor kinase 1 |
Genbank accession: | NM_002929 |
Immunogen: | GRK1 (NP_002920.1, 51 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RDSLSLEFESVCLEQPIGKKLFQQFLQSAEKHLPALELWKDIEDYDTADNDLQPQKAQTILAQYLDPQAKLFCSFLDEGIVAKFKEGPVEIQDGLFQPLL |
Protein accession: | NP_002920.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged GRK1 is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |