GRK1 monoclonal antibody (M02), clone 4E9 View larger

GRK1 monoclonal antibody (M02), clone 4E9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GRK1 monoclonal antibody (M02), clone 4E9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about GRK1 monoclonal antibody (M02), clone 4E9

Brand: Abnova
Reference: H00006011-M02
Product name: GRK1 monoclonal antibody (M02), clone 4E9
Product description: Mouse monoclonal antibody raised against a partial recombinant GRK1.
Clone: 4E9
Isotype: IgG2b Kappa
Gene id: 6011
Gene name: GRK1
Gene alias: GPRK1|RHOK|RK
Gene description: G protein-coupled receptor kinase 1
Genbank accession: NM_002929
Immunogen: GRK1 (NP_002920.1, 51 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RDSLSLEFESVCLEQPIGKKLFQQFLQSAEKHLPALELWKDIEDYDTADNDLQPQKAQTILAQYLDPQAKLFCSFLDEGIVAKFKEGPVEIQDGLFQPLL
Protein accession: NP_002920.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006011-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006011-M02-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged GRK1 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GRK1 monoclonal antibody (M02), clone 4E9 now

Add to cart