RGS10 (Human) Recombinant Protein (P01) View larger

RGS10 (Human) Recombinant Protein (P01)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RGS10 (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about RGS10 (Human) Recombinant Protein (P01)

Brand: Abnova
Reference: H00006001-P01
Product name: RGS10 (Human) Recombinant Protein (P01)
Product description: Human RGS10 full-length ORF ( AAH09361, 1 a.a. - 181 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 6001
Gene name: RGS10
Gene alias: -
Gene description: regulator of G-protein signaling 10
Genbank accession: BC009361
Immunogen sequence/protein sequence: MFNRAVSRLSRKRPPSDIHDSDGSSSSSHQSLKSTAKWAASLENLLEDPEGVKRFREFLKKEFSEENVLFWLACEDFKKMQDKTQMQEKAKEIYMTFLSSKASSQVNVEGQSRLNEKILEEPHPLMFQKLQDQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT
Protein accession: AAH09361
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00006001-P01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Characterization of Regulators of G-protein signaling RGS4 and RGS10 proteins in the postmortem human brain.Rivero G, Gabilondo AM, Garcia-Sevilla JA, La Harpe R, Morentin B, Meana JJ.
Neurochem Int. 2010 Aug 31. [Epub ahead of print]

Reviews

Buy RGS10 (Human) Recombinant Protein (P01) now

Add to cart