RGS10 purified MaxPab mouse polyclonal antibody (B01P) View larger

RGS10 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RGS10 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about RGS10 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00006001-B01P
Product name: RGS10 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human RGS10 protein.
Gene id: 6001
Gene name: RGS10
Gene alias: -
Gene description: regulator of G-protein signaling 10
Genbank accession: NM_001005339.1
Immunogen: RGS10 (NP_001005339.1, 1 a.a. ~ 181 a.a) full-length human protein.
Immunogen sequence/protein sequence: MFNRAVSRLSRKRPPSDIHDSDGSSSSSHQSLKSTAKWAASLENLLEDPEGVKRFREFLKKEFSEENVLFWLACEDFKKMQDKTQMQEKAKEIYMTFLSSKASSQVNVEGQSRLNEKILEEPHPLMFQKLQDQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT
Protein accession: NP_001005339.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006001-B01P-13-15-1.jpg
Application image note: Western Blot analysis of RGS10 expression in transfected 293T cell line (H00006001-T01) by RGS10 MaxPab polyclonal antibody.

Lane 1: RGS10 transfected lysate(19.91 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RGS10 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart