RGS4 monoclonal antibody (M01), clone 2B2 View larger

RGS4 monoclonal antibody (M01), clone 2B2

H00005999-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RGS4 monoclonal antibody (M01), clone 2B2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about RGS4 monoclonal antibody (M01), clone 2B2

Brand: Abnova
Reference: H00005999-M01
Product name: RGS4 monoclonal antibody (M01), clone 2B2
Product description: Mouse monoclonal antibody raised against a full length recombinant RGS4.
Clone: 2B2
Isotype: IgG2b Kappa
Gene id: 5999
Gene name: RGS4
Gene alias: DKFZp761F1924|MGC2124|MGC60244|RGP4|SCZD9
Gene description: regulator of G-protein signaling 4
Genbank accession: BC051869
Immunogen: RGS4 (AAH51869, 1 a.a. ~ 205 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWAESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNPSSCGAEKQKGAKSSADCASLVPQCA
Protein accession: AAH51869
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005999-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (48.29 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005999-M01-13-15-1.jpg
Application image note: Western Blot analysis of RGS4 expression in transfected 293T cell line by RGS4 monoclonal antibody (M01), clone 2B2.

Lane 1: RGS4 transfected lysate(23.3 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RGS4 monoclonal antibody (M01), clone 2B2 now

Add to cart