Brand: | Abnova |
Reference: | H00005998-M01 |
Product name: | RGS3 monoclonal antibody (M01), clone 1E8-C7 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant RGS3. |
Clone: | 1E8-C7 |
Isotype: | IgG1 Kappa |
Gene id: | 5998 |
Gene name: | RGS3 |
Gene alias: | C2PA|FLJ20370|FLJ31516|FLJ90496|PDZ-RGS3|RGP3 |
Gene description: | regulator of G-protein signaling 3 |
Genbank accession: | BC018072 |
Immunogen: | RGS3 (AAH18072, 1 a.a. ~ 192 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MLRGMYLTRNGNLQRRHTMKEAKDMKNKLGIFRRRSESPGAPPAGKADKMMKSFKPTSEEALKWGESLEKLLVHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMASKAKKIFAEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL |
Protein accession: | AAH18072 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (46.86 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to RGS3 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |