RGS3 purified MaxPab rabbit polyclonal antibody (D01P) View larger

RGS3 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RGS3 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about RGS3 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00005998-D01P
Product name: RGS3 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human RGS3 protein.
Gene id: 5998
Gene name: RGS3
Gene alias: C2PA|FLJ20370|FLJ31516|FLJ90496|PDZ-RGS3|RGP3
Gene description: regulator of G-protein signaling 3
Genbank accession: NM_134427
Immunogen: RGS3 (NP_602299.1, 1 a.a. ~ 168 a.a) full-length human protein.
Immunogen sequence/protein sequence: MKNKLGIFRRRNESPGAPPAGKADKMMKSFKPTSEEALKWGESLEKLLVHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMASKAKKIFAEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL
Protein accession: NP_602299.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00005998-D01P-13-15-1.jpg
Application image note: Western Blot analysis of RGS3 expression in transfected 293T cell line (H00005998-T02) by RGS3 MaxPab polyclonal antibody.

Lane 1: RGS3 transfected lysate(19.50 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RGS3 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart