Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RFXAP monoclonal antibody (M01), clone 1B5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Tr |
More info about RFXAP monoclonal antibody (M01), clone 1B5
| Brand: | Abnova |
| Reference: | H00005994-M01 |
| Product name: | RFXAP monoclonal antibody (M01), clone 1B5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RFXAP. |
| Clone: | 1B5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 5994 |
| Gene name: | RFXAP |
| Gene alias: | - |
| Gene description: | regulatory factor X-associated protein |
| Genbank accession: | NM_000538 |
| Immunogen: | RFXAP (NP_000529, 179 a.a. ~ 244 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SDQALNCGGTASTGSAGNVKLEESADNILSIVKQRTGSFGDRPARPTLLEQVLNQKRLSLLRSPEV |
| Protein accession: | NP_000529 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged RFXAP is approximately 3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Tr |
| Shipping condition: | Dry Ice |