RFXAP purified MaxPab rabbit polyclonal antibody (D01P) View larger

RFXAP purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RFXAP purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ti,IF,WB-Tr

More info about RFXAP purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00005994-D01P
Product name: RFXAP purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human RFXAP protein.
Gene id: 5994
Gene name: RFXAP
Gene alias: -
Gene description: regulatory factor X-associated protein
Genbank accession: BC026088.1
Immunogen: RFXAP (AAH26088.1, 1 a.a. ~ 272 a.a) full-length human protein.
Immunogen sequence/protein sequence: MEAQSVAEGAGPGAASGVPHPAALAPAAAPTLAPASVAAAASQFTLLVMQPCAGQDEAAAPGGSVGAGKPVRYLCEGAGDGEEEAGEDEADLLDTSDPPGGGESAASLEDLEDEETHSGGEGSSGGARRRGSGGGSMSKTCTYEGCSETTSQVAKQRKPWMCKKHRNKMYKDKYKKKKSDQALNCGGTASTGSAGNVKLEESADNILSIVKQRTGSFGDRPARPTLLEQVLNQKRLSLLRSPEVVQFLQKQQQLLNQQVLEQRQQQFPGTSM
Protein accession: AAH26088.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00005994-D01P-13-15-1.jpg
Application image note: Western Blot analysis of RFXAP expression in transfected 293T cell line (H00005994-T02) by RFXAP MaxPab polyclonal antibody.

Lane 1: RFXAP transfected lysate(28.30 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RFXAP purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart