RFC4 monoclonal antibody (M02), clone 1B2 View larger

RFC4 monoclonal antibody (M02), clone 1B2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RFC4 monoclonal antibody (M02), clone 1B2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about RFC4 monoclonal antibody (M02), clone 1B2

Brand: Abnova
Reference: H00005984-M02
Product name: RFC4 monoclonal antibody (M02), clone 1B2
Product description: Mouse monoclonal antibody raised against a partial recombinant RFC4.
Clone: 1B2
Isotype: IgG2a Kappa
Gene id: 5984
Gene name: RFC4
Gene alias: A1|MGC27291|RFC37
Gene description: replication factor C (activator 1) 4, 37kDa
Genbank accession: BC017452
Immunogen: RFC4 (AAH17452, 254 a.a. ~ 363 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GKEITEKVITDIAGVIPAEKIDGVFAACQSGSFDKLEAVVKDLIDEGHAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDKCLADGADEHLQLISLCATVMQQLSQNC
Protein accession: AAH17452
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005984-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005984-M02-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged RFC4 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RFC4 monoclonal antibody (M02), clone 1B2 now

Add to cart