RFC4 purified MaxPab mouse polyclonal antibody (B01P) View larger

RFC4 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RFC4 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,WB-Ti,WB-Tr

More info about RFC4 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00005984-B01P
Product name: RFC4 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human RFC4 protein.
Gene id: 5984
Gene name: RFC4
Gene alias: A1|MGC27291|RFC37
Gene description: replication factor C (activator 1) 4, 37kDa
Genbank accession: NM_002916
Immunogen: RFC4 (NP_002907.1, 1 a.a. ~ 363 a.a) full-length human protein.
Immunogen sequence/protein sequence: MQAFLKGTSISTKPPLTKDRGVAASAGSSGENKKAKPVPWVEKYRPKCVDEVAFQEEVVAVLKKSLEGADLPNLLFYGPPGTGKTSTILAAARELFGPELFRLRVLELNASDERGIQVVREKVKNFAQLTVSGSRSDGKPCPPFKIVILDEADSMTSAAQAALRRTMEKESKTTRFCLICNYVSRIIEPLTSRCSKFRFKPLSDKIQQQRLLDIAKKENVKISDEGIAYLVKVSEGDLRKAITFLQSATRLTGGKEITEKVITDIAGVIPAEKIDGVFAACQSGSFDKLEAVVKDLIDEGHAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDKCLADGADEHLQLISLCATVMQQLSQNC
Protein accession: NP_002907.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005984-B01P-13-15-1.jpg
Application image note: Western Blot analysis of RFC4 expression in transfected 293T cell line (H00005984-T01) by RFC4 MaxPab polyclonal antibody.

Lane 1: RFC4 transfected lysate(39.93 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RFC4 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart