RFC1 monoclonal antibody (M01), clone 3F8 View larger

RFC1 monoclonal antibody (M01), clone 3F8

H00005981-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RFC1 monoclonal antibody (M01), clone 3F8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about RFC1 monoclonal antibody (M01), clone 3F8

Brand: Abnova
Reference: H00005981-M01
Product name: RFC1 monoclonal antibody (M01), clone 3F8
Product description: Mouse monoclonal antibody raised against a partial recombinant RFC1.
Clone: 3F8
Isotype: IgG3 Kappa
Gene id: 5981
Gene name: RFC1
Gene alias: A1|MGC51786|MHCBFB|PO-GA|RECC1|RFC|RFC140
Gene description: replication factor C (activator 1) 1, 145kDa
Genbank accession: BC051786
Immunogen: RFC1 (AAH51786, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MDIRKFFGVIPSGKKLVSETVKKNEKTKSDEETLKAKKGIKEIKVNSSRKEDDFKQKQPSKKKRIIYDSDSESEETLQVKNAKKPPEKLPVSSKPGKISRQDPVTYISET
Protein accession: AAH51786
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005981-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.51 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005981-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged RFC1 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RFC1 monoclonal antibody (M01), clone 3F8 now

Add to cart