Brand: | Abnova |
Reference: | H00005979-A01 |
Product name: | RET polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant RET. |
Gene id: | 5979 |
Gene name: | RET |
Gene alias: | CDHF12|HSCR1|MEN2A|MEN2B|MTC1|PTC|RET-ELE1|RET51 |
Gene description: | ret proto-oncogene |
Genbank accession: | BC003072 |
Immunogen: | RET (AAH03072, 361 a.a. ~ 458 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | NLSISENRTMQLAVLVNDSDFQGPGAGVLLLHFNVSVLPVSLHLPSTYSLSVSRRARRFAQIGKVCVENCLADLTGDAVSGRDEARSSGLGSQKHPGS |
Protein accession: | AAH03072 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.89 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |