Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of DPF2 monoclonal antibody (M01), clone 2F6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,IF,ELISA,WB-Re,WB-Tr |
More info about DPF2 monoclonal antibody (M01), clone 2F6
| Brand: | Abnova |
| Reference: | H00005977-M01 |
| Product name: | DPF2 monoclonal antibody (M01), clone 2F6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DPF2. |
| Clone: | 2F6 |
| Isotype: | IgG2a kappa |
| Gene id: | 5977 |
| Gene name: | DPF2 |
| Gene alias: | MGC10180|REQ|UBID4|ubi-d4 |
| Gene description: | D4, zinc and double PHD fingers family 2 |
| Genbank accession: | BC014889 |
| Immunogen: | DPF2 (AAH14889, 56 a.a. ~ 155 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | WMEKRHRGPGLASGQLYSYPARRWRKKRRAHPPEDPRLSFPSIKPDTDQTLKKEGLISQDGSSLEALLRTDPLEKRGAPDPRVDDDSLGEFPVTNSRARK |
| Protein accession: | AAH14889 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to DPF2 on formalin-fixed paraffin-embedded human ovary, clear cell carcinoma. [antibody concentration 6 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Transient and etiology-related transcription regulation in cirrhosis prior to hepatocellular carcinoma occurrence.Caillot F, Derambure C, Bioulac-Sage P, Francois A, Scotte M, Goria O, Hiron M, Daveau M, Salier JP. World J Gastroenterol. 2009 Jan 21;15(3):300-9. |