UPF1 monoclonal antibody (M01), clone 4G3 View larger

UPF1 monoclonal antibody (M01), clone 4G3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UPF1 monoclonal antibody (M01), clone 4G3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about UPF1 monoclonal antibody (M01), clone 4G3

Brand: Abnova
Reference: H00005976-M01
Product name: UPF1 monoclonal antibody (M01), clone 4G3
Product description: Mouse monoclonal antibody raised against a partial recombinant UPF1.
Clone: 4G3
Isotype: IgG2a Kappa
Gene id: 5976
Gene name: UPF1
Gene alias: FLJ43809|FLJ46894|HUPF1|KIAA0221|NORF1|RENT1|pNORF1
Gene description: UPF1 regulator of nonsense transcripts homolog (yeast)
Genbank accession: NM_002911
Immunogen: UPF1 (NP_002902.2, 1019 a.a. ~ 1116 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GRQKNRFGLPGPSQTNLPNSQASQDVASQPFSQGALTQGYISMSQPSQMSQPGLSQPELSQDSYLGDEFKSQIDVALSQDSTYQGERAYQHGGVTGLS
Protein accession: NP_002902.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005976-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005976-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged UPF1 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy UPF1 monoclonal antibody (M01), clone 4G3 now

Add to cart