Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RDH5 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about RDH5 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00005959-A01 |
| Product name: | RDH5 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant RDH5. |
| Gene id: | 5959 |
| Gene name: | RDH5 |
| Gene alias: | FLJ39337|FLJ97089|HSD17B9|RDH1|SDR9C5 |
| Gene description: | retinol dehydrogenase 5 (11-cis/9-cis) |
| Genbank accession: | BC028298 |
| Immunogen: | RDH5 (AAH28298, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | GLEAFSDSLRRDVAHFGIRVSIVEPGFFRTPVTNLESLEKTLQACWARLPPATQAHYGGAFLTKYLKMQQRIMNLICDPDLTKVSRCLEHALTARHPRTR |
| Protein accession: | AAH28298 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | A low carbohydrate, high protein diet suppresses intratumoral androgen synthesis and slows castration-resistant prostate tumor growth in mice.Fokidis HB, Yieng Chin M, Ho VW, Adomat HH, Soma KK, Fazli L, Nip KM, Cox M, Krystal G, Zoubeidi A, Tomlinson Guns ES. J Steroid Biochem Mol Biol. 2015 Jun;150:35-45. |