Brand: | Abnova |
Reference: | H00005957-M42A |
Product name: | RCV1 monoclonal antibody (M42A), clone 3H1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RCV1. |
Clone: | 3H1 |
Isotype: | IgG2a Kappa |
Gene id: | 5957 |
Gene name: | RCVRN |
Gene alias: | RCV1 |
Gene description: | recoverin |
Genbank accession: | BC001720 |
Immunogen: | RCV1 (AAH01720.1, 91 a.a. ~ 181 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | HMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKE |
Protein accession: | AAH01720.1 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoprecipitation of RCVRN transfected lysate using anti-RCVRN monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with RCVRN MaxPab rabbit polyclonal antibody. |
Applications: | ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |