Brand: | Abnova |
Reference: | H00005957-M37 |
Product name: | RCV1 monoclonal antibody (M37), clone 3F6 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant RCV1. |
Clone: | 3F6 |
Isotype: | IgG2a Kappa |
Gene id: | 5957 |
Gene name: | RCVRN |
Gene alias: | RCV1 |
Gene description: | recoverin |
Genbank accession: | BC001720 |
Immunogen: | RCV1 (AAH01720, 1 a.a. ~ 200 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MGNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA |
Protein accession: | AAH01720 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (47.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | RCV1 monoclonal antibody (M37), clone 3F6. Western Blot analysis of RCV1 expression in A-431 ( Cat # L015V1 ). |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |