RCVRN monoclonal antibody (M24C), clone 1E10 View larger

RCVRN monoclonal antibody (M24C), clone 1E10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RCVRN monoclonal antibody (M24C), clone 1E10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about RCVRN monoclonal antibody (M24C), clone 1E10

Brand: Abnova
Reference: H00005957-M24C
Product name: RCVRN monoclonal antibody (M24C), clone 1E10
Product description: Mouse monoclonal antibody raised against a partial recombinant RCVRN.
Clone: 1E10
Isotype: IgG2a Kappa
Gene id: 5957
Gene name: RCVRN
Gene alias: RCV1
Gene description: recoverin
Genbank accession: NM_002903.1
Immunogen: RCVRN (NP_002894.1, 3 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTN
Protein accession: NP_002894.1
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005957-M24C-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.3 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RCVRN monoclonal antibody (M24C), clone 1E10 now

Add to cart