RCV1 monoclonal antibody (M07), clone 4H2 View larger

RCV1 monoclonal antibody (M07), clone 4H2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RCV1 monoclonal antibody (M07), clone 4H2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about RCV1 monoclonal antibody (M07), clone 4H2

Brand: Abnova
Reference: H00005957-M07
Product name: RCV1 monoclonal antibody (M07), clone 4H2
Product description: Mouse monoclonal antibody raised against a partial recombinant RCV1.
Clone: 4H2
Isotype: IgG2a Kappa
Gene id: 5957
Gene name: RCVRN
Gene alias: RCV1
Gene description: recoverin
Genbank accession: NM_002903.1
Immunogen: RCV1 (NP_002894.1, 101 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKN
Protein accession: NP_002894.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005957-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005957-M07-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged RCV1 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RCV1 monoclonal antibody (M07), clone 4H2 now

Add to cart