RCV1 monoclonal antibody (M02A), clone 3G10 View larger

RCV1 monoclonal antibody (M02A), clone 3G10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RCV1 monoclonal antibody (M02A), clone 3G10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr,IP

More info about RCV1 monoclonal antibody (M02A), clone 3G10

Brand: Abnova
Reference: H00005957-M02A
Product name: RCV1 monoclonal antibody (M02A), clone 3G10
Product description: Mouse monoclonal antibody raised against a partial recombinant RCV1.
Clone: 3G10
Isotype: IgG1 Kappa
Gene id: 5957
Gene name: RCVRN
Gene alias: RCV1
Gene description: recoverin
Genbank accession: NM_002903.1
Immunogen: RCV1 (NP_002894.1, 101 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKN
Protein accession: NP_002894.1
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005957-M02A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005957-M02A-31-15-1.jpg
Application image note: Immunoprecipitation of RCVRN transfected lysate using anti-RCVRN monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with RCVRN MaxPab rabbit polyclonal antibody.
Applications: ELISA,WB-Re,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy RCV1 monoclonal antibody (M02A), clone 3G10 now

Add to cart