RBP3 monoclonal antibody (M01), clone 4F3 View larger

RBP3 monoclonal antibody (M01), clone 4F3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RBP3 monoclonal antibody (M01), clone 4F3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about RBP3 monoclonal antibody (M01), clone 4F3

Brand: Abnova
Reference: H00005949-M01
Product name: RBP3 monoclonal antibody (M01), clone 4F3
Product description: Mouse monoclonal antibody raised against a partial recombinant RBP3.
Clone: 4F3
Isotype: IgG2a Kappa
Gene id: 5949
Gene name: RBP3
Gene alias: D10S64|D10S65|D10S66|IRBP|RBPI
Gene description: retinol binding protein 3, interstitial
Genbank accession: NM_002900
Immunogen: RBP3 (NP_002891, 1149 a.a. ~ 1246 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GTAEEFTYIMKRLGRALVIGEVTSGGCQPPQTYHVDDTNLYLTIPTARSVGASDGSSWEGVGVTPHVVVPAEEALARAKEMLQHNQLRVKRSPGLQDH
Protein accession: NP_002891
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005949-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005949-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged RBP3 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RBP3 monoclonal antibody (M01), clone 4F3 now

Add to cart