RBMS2 monoclonal antibody (M03), clone 3B2 View larger

RBMS2 monoclonal antibody (M03), clone 3B2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RBMS2 monoclonal antibody (M03), clone 3B2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA,WB-Re

More info about RBMS2 monoclonal antibody (M03), clone 3B2

Brand: Abnova
Reference: H00005939-M03
Product name: RBMS2 monoclonal antibody (M03), clone 3B2
Product description: Mouse monoclonal antibody raised against a partial recombinant RBMS2.
Clone: 3B2
Isotype: IgG2a Kappa
Gene id: 5939
Gene name: RBMS2
Gene alias: FLJ39093|FLJ40023|FLJ43262|SCR3
Gene description: RNA binding motif, single stranded interacting protein 2
Genbank accession: NM_002898
Immunogen: RBMS2 (NP_002889, 308 a.a. ~ 407 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: HHHSYLMQPSGSVLTPGMDHPISLQPASMMGPLTQQLGHLSLSSTGTYMPTAAAMQGAYISQYTPVPSSSVSVEESSGQQNQVAVDAPSEHGVYSFQFN*
Protein accession: NP_002889
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005939-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005939-M03-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to RBMS2 on HeLa cell . [antibody concentration 10 ug/ml]
Applications: IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RBMS2 monoclonal antibody (M03), clone 3B2 now

Add to cart