Brand: | Abnova |
Reference: | H00005939-M03 |
Product name: | RBMS2 monoclonal antibody (M03), clone 3B2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RBMS2. |
Clone: | 3B2 |
Isotype: | IgG2a Kappa |
Gene id: | 5939 |
Gene name: | RBMS2 |
Gene alias: | FLJ39093|FLJ40023|FLJ43262|SCR3 |
Gene description: | RNA binding motif, single stranded interacting protein 2 |
Genbank accession: | NM_002898 |
Immunogen: | RBMS2 (NP_002889, 308 a.a. ~ 407 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | HHHSYLMQPSGSVLTPGMDHPISLQPASMMGPLTQQLGHLSLSSTGTYMPTAAAMQGAYISQYTPVPSSSVSVEESSGQQNQVAVDAPSEHGVYSFQFN* |
Protein accession: | NP_002889 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to RBMS2 on HeLa cell . [antibody concentration 10 ug/ml] |
Applications: | IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |