RBL2 monoclonal antibody (M08), clone 2H7 View larger

RBL2 monoclonal antibody (M08), clone 2H7

H00005934-M08_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RBL2 monoclonal antibody (M08), clone 2H7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about RBL2 monoclonal antibody (M08), clone 2H7

Brand: Abnova
Reference: H00005934-M08
Product name: RBL2 monoclonal antibody (M08), clone 2H7
Product description: Mouse monoclonal antibody raised against a partial recombinant RBL2.
Clone: 2H7
Isotype: IgG2a Kappa
Gene id: 5934
Gene name: RBL2
Gene alias: FLJ26459|P130|Rb2
Gene description: retinoblastoma-like 2 (p130)
Genbank accession: NM_005611
Immunogen: RBL2 (NP_005602, 416 a.a. ~ 515 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VTPVSTATHSLSRLHTMLTGLRNAPSEKLEQILRTCSRDPTQAIANRLKEMFEIYSQHFQPDEDFSNCAKEIASKHFRFAEMLYYKVLESVIEQEQKRLG
Protein accession: NP_005602
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005934-M08-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged RBL2 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy RBL2 monoclonal antibody (M08), clone 2H7 now

Add to cart