Brand: | Abnova |
Reference: | H00005928-D01P |
Product name: | RBBP4 purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human RBBP4 protein. |
Gene id: | 5928 |
Gene name: | RBBP4 |
Gene alias: | NURF55|RBAP48 |
Gene description: | retinoblastoma binding protein 4 |
Genbank accession: | NM_005610 |
Immunogen: | RBBP4 (NP_005601.1, 1 a.a. ~ 425 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS |
Protein accession: | NP_005601.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | RBBP4 MaxPab rabbit polyclonal antibody. Western Blot analysis of RBBP4 expression in HeLa. |
Applications: | WB-Ce |
Shipping condition: | Dry Ice |