ARID4A monoclonal antibody (M01), clone 2G8 View larger

ARID4A monoclonal antibody (M01), clone 2G8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ARID4A monoclonal antibody (M01), clone 2G8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA,WB-Re

More info about ARID4A monoclonal antibody (M01), clone 2G8

Brand: Abnova
Reference: H00005926-M01
Product name: ARID4A monoclonal antibody (M01), clone 2G8
Product description: Mouse monoclonal antibody raised against a partial recombinant ARID4A.
Clone: 2G8
Isotype: IgG1 Kappa
Gene id: 5926
Gene name: ARID4A
Gene alias: RBBP1|RBP-1|RBP1
Gene description: AT rich interactive domain 4A (RBP1-like)
Genbank accession: NM_002892
Immunogen: ARID4A (NP_002883, 1033 a.a. ~ 1139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AEESQEGLCERESANGFETNVASGTCSIIVQERESREKGQKRPSDGNSGLMAKKQKRTPKRTSAAAKNEKNGTGQSSDSEDLPVLDNSSKCTPVKHLNVSKPQKLAR
Protein accession: NP_002883
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005926-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.51 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005926-M01-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to ARID4A on HeLa cell . [antibody concentration 10 ug/ml]
Applications: IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ARID4A monoclonal antibody (M01), clone 2G8 now

Add to cart