RASA1 monoclonal antibody (M01A), clone 2C12 View larger

RASA1 monoclonal antibody (M01A), clone 2C12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RASA1 monoclonal antibody (M01A), clone 2C12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about RASA1 monoclonal antibody (M01A), clone 2C12

Brand: Abnova
Reference: H00005921-M01A
Product name: RASA1 monoclonal antibody (M01A), clone 2C12
Product description: Mouse monoclonal antibody raised against a partial recombinant RASA1.
Clone: 2C12
Isotype: IgG1 Kappa
Gene id: 5921
Gene name: RASA1
Gene alias: CM-AVM|CMAVM|DKFZp434N071|GAP|PKWS|RASA|RASGAP|p120GAP|p120RASGAP
Gene description: RAS p21 protein activator (GTPase activating protein) 1
Genbank accession: NM_002890
Immunogen: RASA1 (NP_002881, 948 a.a. ~ 1047 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AKEPYMEGVNPFIKSNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRTLSNERGAQQHVLKKLLAITELLQQKQNQYTKTNDVR
Protein accession: NP_002881
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005921-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005921-M01A-1-19-1.jpg
Application image note: RASA1 monoclonal antibody (M01A), clone 2C12 Western Blot analysis of RASA1 expression in IMR-32 ( Cat # L008V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RASA1 monoclonal antibody (M01A), clone 2C12 now

Add to cart