Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,WB-Tr |
Brand: | Abnova |
Reference: | H00005920-B02P |
Product name: | RARRES3 purified MaxPab mouse polyclonal antibody (B02P) |
Product description: | Mouse polyclonal antibody raised against a full-length human RARRES3 protein. |
Gene id: | 5920 |
Gene name: | RARRES3 |
Gene alias: | HRASLS4|MGC8906|RIG1|TIG3 |
Gene description: | retinoic acid receptor responder (tazarotene induced) 3 |
Genbank accession: | BC009678.1 |
Immunogen: | RARRES3 (AAH09678.1, 1 a.a. ~ 164 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MASPHQEPKPGDLIEIFRLGYEHWALYIGDGYVIHLAPPSEYPGAGSSSVFSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMVGQKMKYSIVSRNCEHFVTQLRYGKSRCKQVEKAKVEVGVATALGILVVAGCSFAIRRYQKKATA |
Protein accession: | AAH09678.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of RARRES3 expression in transfected 293T cell line (H00005920-T02) by RARRES3 MaxPab polyclonal antibody. Lane 1: RARRES3 transfected lysate(18.04 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,WB-Tr |
Shipping condition: | Dry Ice |