RARRES2 monoclonal antibody (M23), clone 3B4 View larger

RARRES2 monoclonal antibody (M23), clone 3B4

H00005919-M23_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RARRES2 monoclonal antibody (M23), clone 3B4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about RARRES2 monoclonal antibody (M23), clone 3B4

Brand: Abnova
Reference: H00005919-M23
Product name: RARRES2 monoclonal antibody (M23), clone 3B4
Product description: Mouse monoclonal antibody raised against a full-length recombinant RARRES2.
Clone: 3B4
Isotype: IgG2a Kappa
Gene id: 5919
Gene name: RARRES2
Gene alias: CHEMERIN|HP10433|TIG2
Gene description: retinoic acid receptor responder (tazarotene induced) 2
Genbank accession: NM_002889.2
Immunogen: RARRES2 (NP_002880.1, 17 a.a. ~ 163 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VGVAELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFSKALPRS
Protein accession: NP_002880.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005919-M23-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (41.8 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RARRES2 monoclonal antibody (M23), clone 3B4 now

Add to cart