Brand: | Abnova |
Reference: | H00005919-M22 |
Product name: | RARRES2 monoclonal antibody (M22), clone 2A5 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant RARRES2. |
Clone: | 2A5 |
Isotype: | IgG2a Kappa |
Gene id: | 5919 |
Gene name: | RARRES2 |
Gene alias: | CHEMERIN|HP10433|TIG2 |
Gene description: | retinoic acid receptor responder (tazarotene induced) 2 |
Genbank accession: | NM_002889.2 |
Immunogen: | RARRES2 (NP_002880.1, 17 a.a. ~ 163 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VGVAELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFSKALPRS |
Protein accession: | NP_002880.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |