RARRES2 monoclonal antibody (M15), clone 3E3 View larger

RARRES2 monoclonal antibody (M15), clone 3E3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RARRES2 monoclonal antibody (M15), clone 3E3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about RARRES2 monoclonal antibody (M15), clone 3E3

Brand: Abnova
Reference: H00005919-M15
Product name: RARRES2 monoclonal antibody (M15), clone 3E3
Product description: Mouse monoclonal antibody raised against a partial recombinant RARRES2.
Clone: 3E3
Isotype: IgG2a Kappa
Gene id: 5919
Gene name: RARRES2
Gene alias: CHEMERIN|HP10433|TIG2
Gene description: retinoic acid receptor responder (tazarotene induced) 2
Genbank accession: NM_002889
Immunogen: RARRES2 (NP_002880.1, 17 a.a. ~ 163 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VGVAELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFSKALPRS
Protein accession: NP_002880.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005919-M15-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (41.8 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005919-M15-13-15-1.jpg
Application image note: Western Blot analysis of RARRES2 expression in transfected 293T cell line by RARRES2 monoclonal antibody (M02), clone 3E3.

Lane 1: RARRES2 transfected lysate(18.6 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RARRES2 monoclonal antibody (M15), clone 3E3 now

Add to cart