RARRES1 monoclonal antibody (M06), clone 2E2 View larger

RARRES1 monoclonal antibody (M06), clone 2E2

H00005918-M06_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RARRES1 monoclonal antibody (M06), clone 2E2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about RARRES1 monoclonal antibody (M06), clone 2E2

Brand: Abnova
Reference: H00005918-M06
Product name: RARRES1 monoclonal antibody (M06), clone 2E2
Product description: Mouse monoclonal antibody raised against a partial recombinant RARRES1.
Clone: 2E2
Isotype: IgG2a Kappa
Gene id: 5918
Gene name: RARRES1
Gene alias: TIG1
Gene description: retinoic acid receptor responder (tazarotene induced) 1
Genbank accession: NM_206963
Immunogen: RARRES1 (NP_996846, 205 a.a. ~ 294 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EMTTQVSHYYLAQLTSVRQWKTNDDTIDFDYTVLLHELSTQEIIPCRIHLVWYPGKPLKVKYHCQELQTPEEASGTEEGSAVVPTELSNF
Protein accession: NP_996846
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005918-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.64 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005918-M06-1-2-1.jpg
Application image note: RARRES1 monoclonal antibody (M06), clone 2E2. Western Blot analysis of RARRES1 expression in HL-60(Cat # L014V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RARRES1 monoclonal antibody (M06), clone 2E2 now

Add to cart