RARB purified MaxPab mouse polyclonal antibody (B01P) View larger

RARB purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RARB purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about RARB purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00005915-B01P
Product name: RARB purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human RARB protein.
Gene id: 5915
Gene name: RARB
Gene alias: HAP|NR1B2|RRB2
Gene description: retinoic acid receptor, beta
Genbank accession: NM_000965.2
Immunogen: RARB (NP_000956.2, 1 a.a. ~ 448 a.a) full-length human protein.
Immunogen sequence/protein sequence: MFDCMDVLSVSPGQILDFYTASPSSCMLQEKALKACFSGLTQTEWQHRHTAQSIETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ
Protein accession: NP_000956.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005915-B01P-13-15-1.jpg
Application image note: Western Blot analysis of RARB expression in transfected 293T cell line (H00005915-T01) by RARB MaxPab polyclonal antibody.

Lane 1: RARB transfected lysate(49.28 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RARB purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart