RARA purified MaxPab mouse polyclonal antibody (B01P) View larger

RARA purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RARA purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about RARA purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00005914-B01P
Product name: RARA purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human RARA protein.
Gene id: 5914
Gene name: RARA
Gene alias: NR1B1|RAR
Gene description: retinoic acid receptor, alpha
Genbank accession: DQ893744.2
Immunogen: RARA (ABM84670.1, 1 a.a. ~ 462 a.a) full-length human protein.
Immunogen sequence/protein sequence: MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSGGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP
Protein accession: ABM84670.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005914-B01P-13-15-1.jpg
Application image note: Western Blot analysis of RARA expression in transfected 293T cell line (H00005914-T02) by RARA MaxPab polyclonal antibody.

Lane 1: RARA transfected lysate(50.82 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RARA purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart