Brand: | Abnova |
Reference: | H00005912-A01 |
Product name: | RAP2B polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a full-length recombinant RAP2B. |
Gene id: | 5912 |
Gene name: | RAP2B |
Gene alias: | MGC20484 |
Gene description: | RAP2B, member of RAS oncogene family |
Genbank accession: | BC012362 |
Immunogen: | RAP2B (AAH12362, 1 a.a. ~ 183 a.a) full-length recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVPMILVGNKVDLEGEREVSYGEGKALAEEWSCPFMETSAKNKASVDELFAEIVRQMNYAAQPNGDEGCCSACVIL |
Protein accession: | AAH12362 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (46.24 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |