Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ti,WB-Tr |
Brand: | Abnova |
Reference: | H00005899-B01 |
Product name: | RALB MaxPab mouse polyclonal antibody (B01) |
Product description: | Mouse polyclonal antibody raised against a full-length human RALB protein. |
Gene id: | 5899 |
Gene name: | RALB |
Gene alias: | - |
Gene description: | v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein) |
Genbank accession: | NM_002881 |
Immunogen: | RALB (NP_002872, 1 a.a. ~ 206 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKERCCLL |
Protein accession: | NP_002872 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of RALB expression in transfected 293T cell line (H00005899-T01) by RALB MaxPab polyclonal antibody. Lane 1: RALB transfected lysate(22.66 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ti,WB-Tr |
Shipping condition: | Dry Ice |