RAD51L1 purified MaxPab rabbit polyclonal antibody (D01P) View larger

RAD51L1 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RAD51L1 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about RAD51L1 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00005890-D01P
Product name: RAD51L1 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human RAD51L1 protein.
Gene id: 5890
Gene name: RAD51L1
Gene alias: MGC34245|R51H2|RAD51B|REC2|hREC2
Gene description: RAD51-like 1 (S. cerevisiae)
Genbank accession: NM_133509
Immunogen: RAD51L1 (NP_598193.2, 1 a.a. ~ 384 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGSKKLKRVGLSQELCDRLSRHQILTCQDFLCLSPLELMKVTGLSYRGVHELLCMVSRACAPKMQTAYGIKAQRSADFSPAFLSTTLSALDEALHGGVACGSLTEITGPPGCGKTQFCIMMSILATLPTNMGGLEGAVVYIDTESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRIESLEEEIISKGIKLVILDSVASVVRKEFDAQLQGNLKERNKFLAREASSLKYLAEEFSIPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTWSHSVNTRLILQYLDSERRQILIAKSPLAPFTSFVYTIKEEGLVLQETTFCSVTQAELNWAPEILPPQPPEQLGLQMCHHTQLIF
Protein accession: NP_598193.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00005890-D01P-13-15-1.jpg
Application image note: Western Blot analysis of RAD51L1 expression in transfected 293T cell line (H00005890-T02) by RAD51L1 MaxPab polyclonal antibody.

Lane 1: RAD51L1 transfected lysate(42.20 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RAD51L1 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart