Brand: | Abnova |
Reference: | H00005889-M01 |
Product name: | RAD51C monoclonal antibody (M01), clone 3F3-5C6 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant RAD51C. |
Clone: | 3F3-5C6 |
Isotype: | IgG1 kappa |
Gene id: | 5889 |
Gene name: | RAD51C |
Gene alias: | MGC104277|RAD51L2 |
Gene description: | RAD51 homolog C (S. cerevisiae) |
Genbank accession: | BC000667 |
Immunogen: | RAD51C (AAH00667.1, 1 a.a. ~ 134 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MRGKTFRFEMQRDLVSFPLSPAVRVKLVSAGFQTAEELLEVKPSELSKEVGISKAEALETLQIIRRECLTNKPRYAGTSESHKKCTALELLEQEHTQGFIITFCSALDDILGGGVPLMKTTEICGAPGVGKTQL |
Protein accession: | AAH00667.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (40.48 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | RAD51C monoclonal antibody (M01), clone 3F3-5C6 Western Blot analysis of RAD51C expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Shipping condition: | Dry Ice |