RAD51C monoclonal antibody (M01), clone 3F3-5C6 View larger

RAD51C monoclonal antibody (M01), clone 3F3-5C6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RAD51C monoclonal antibody (M01), clone 3F3-5C6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab

More info about RAD51C monoclonal antibody (M01), clone 3F3-5C6

Brand: Abnova
Reference: H00005889-M01
Product name: RAD51C monoclonal antibody (M01), clone 3F3-5C6
Product description: Mouse monoclonal antibody raised against a full length recombinant RAD51C.
Clone: 3F3-5C6
Isotype: IgG1 kappa
Gene id: 5889
Gene name: RAD51C
Gene alias: MGC104277|RAD51L2
Gene description: RAD51 homolog C (S. cerevisiae)
Genbank accession: BC000667
Immunogen: RAD51C (AAH00667.1, 1 a.a. ~ 134 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MRGKTFRFEMQRDLVSFPLSPAVRVKLVSAGFQTAEELLEVKPSELSKEVGISKAEALETLQIIRRECLTNKPRYAGTSESHKKCTALELLEQEHTQGFIITFCSALDDILGGGVPLMKTTEICGAPGVGKTQL
Protein accession: AAH00667.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005889-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (40.48 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005889-M01-1-1-1.jpg
Application image note: RAD51C monoclonal antibody (M01), clone 3F3-5C6 Western Blot analysis of RAD51C expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab
Shipping condition: Dry Ice

Reviews

Buy RAD51C monoclonal antibody (M01), clone 3F3-5C6 now

Add to cart